PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10036413
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB_related
Protein Properties Length: 234aa    MW: 26770.7 Da    PI: 5.9899
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10036413genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.94.6e-13114158347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+ E++l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
      Lus10036413 114 PWTEAEHKLFLIGLSKYGKGDWRSISRNIVVSRTPTQVASHAQKY 158
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512935.991558IPR017884SANT domain
SMARTSM007179.0E-8657IPR001005SANT/Myb domain
SuperFamilySSF466896.65E-13863IPR009057Homeodomain-like
CDDcd001678.63E-61055No hitNo description
PROSITE profilePS5129420.088107163IPR017930Myb domain
SuperFamilySSF466894.64E-16108164IPR009057Homeodomain-like
TIGRFAMsTIGR015578.5E-17110162IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.8E-10111157IPR009057Homeodomain-like
SMARTSM007177.6E-10111161IPR001005SANT/Myb domain
PfamPF002497.7E-11114158IPR001005SANT/Myb domain
CDDcd001671.82E-8114159No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MYQEPYSDHW TRSDDKKFEQ ALVFFPEDSP GRWLNIAHHM GRPVAQVMEH YNLLLRDVYE  60
IDSGRVELPT YLDDDVDNWR SSAAVEEEED SGQISFSGGK TTKHGETERK KGTPWTEAEH  120
KLFLIGLSKY GKGDWRSISR NIVVSRTPTQ VASHAQKYFL RQSSVKKERK RSSIHDITNV  180
DMNALSPCSL QGQNQMQQQQ QEEEISALAS SYLPDHHQQE GYLMGFNSSG FPM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013622270.15e-82PREDICTED: transcription factor DIVARICATA-like
TrEMBLA0A078CY085e-82A0A078CY08_BRANA; BnaC03g01730D protein
TrEMBLA0A0D3AZR16e-82A0A0D3AZR1_BRAOL; Uncharacterized protein
STRINGscaffold_600421.11e-80(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.16e-77MYB family protein